PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0022ss01850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family B3
Protein Properties Length: 297aa    MW: 33954.9 Da    PI: 10.1646
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0022ss01850.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B346.56.4e-1517981198
                       HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                 B3 11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98
                       +k+ + ++p +f++++g +   s+  t++ ++gr+W+++l  +k+++ +++++ W+eFv+   L  g  ++F+++g+s+f  +v +f+
  Vang0022ss01850.1 17 SKHFLKRIPEEFIKRFGDE--LSTVATITVPDGRVWKMRL--KKYGKDVFFGSTWREFVNYYSLGYGSHLIFRYVGNSKF--RVLIFD 98
                       5667779******999865..88899999***********..**********************************9999..888886 PP

2B347.24.1e-152112841288
                        HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
                 B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                        ks+rl+++ +fa ++ ++   ++ ++l++++g++W+v ++   + ++ ++++GW +F ++n+L egD ++++l++r+
  Vang0022ss01850.1 211 KSSRLYVSTEFACKYLKP---GVGMMLQNSNGEQWDVSCSCHSRCRALIISRGWAKFMRDNDLSEGDQCLLELIKRD 284
                        7899********999444...356***************98888888*************************99864 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100171.09E-151798No hitNo description
PfamPF023623.2E-121798IPR003340B3 DNA binding domain
SuperFamilySSF1019361.14E-192099IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.3E-920100IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.2E-182398IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.63224100IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-13202284IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.24E-14203284IPR015300DNA-binding pseudobarrel domain
SMARTSM010199.0E-7205293IPR003340B3 DNA binding domain
CDDcd100171.03E-14209284No hitNo description
PfamPF023623.2E-13210284IPR003340B3 DNA binding domain
PROSITE profilePS508639.756232296IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MEDRRRKHGG GSSERESKHF LKRIPEEFIK RFGDELSTVA TITVPDGRVW KMRLKKYGKD  60
VFFGSTWREF VNYYSLGYGS HLIFRYVGNS KFRVLIFDIT AAEICYPLQT RGTNKPNWKR  120
SKFENEQHHG HETKKKKRMV GNGVETKDED DVNLIRPSET KGRKKKGDCS HGKQVKSGCR  180
GNHSSWKIGK DVATASDRLM PRNPFVTCTI KSSRLYVSTE FACKYLKPGV GMMLQNSNGE  240
QWDVSCSCHS RCRALIISRG WAKFMRDNDL SEGDQCLLEL IKRDPIVLKC TVPGEA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523279.10.0PREDICTED: B3 domain-containing protein At4g01580-like
TrEMBLA0A0L9UK160.0A0A0L9UK16_PHAAN; Uncharacterized protein
STRINGGLYMA04G43620.29e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14054820
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-35B3 family protein